Invitrogen™ Human RGS14 (aa 169-240) Control Fragment Recombinant Protein

Product Code. 30197470

Brand: Invitrogen™ RP96926

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111248 (PA5-111248. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RGS14 is a member of the regulator of G-protein signaling family which contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. RGS14 attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. The resulting hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. Alternate transcriptional splice variants of RGS14 have been observed but have not been thoroughly characterized. Further, RGS14 acts as a positive modulator of microtubule polymerisation and spindle organization through a G(i)-alpha-dependent mechanism; plays a role in cell division; is required for the nerve growth factor (NGF)-mediated neurite outgrowth, and is involved in stress resistance. RGS14 protein may also be involved in visual memory processing capacity and hippocampal-based learning and memory.

Specifications

• Accession Number: O43566
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10636
• Name: Human RGS14 (aa 169-240) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: rap1/rap2 interacting protein; RAP1/RAP2-interacting protein; Regulator of G-protein signaling 14; regulator of G-protein signalling 14; RGS14; RGSE; RPIP1
• Common Name: RGS14
• Gene Symbol: Rgs14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining