Invitrogen™ Human RGS12 (aa 233-321) Control Fragment Recombinant Protein

Product Code. 30210578

Brand: Invitrogen™ RP107572

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66919 (PA5-66919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the 'regulator of G protein signaling' (RGS) gene family. The encoded protein may function as a guanosine triphosphatase (GTPase)-activating protein as well as a transcriptional repressor. This protein may play a role in tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their biological nature has not been determined.

Specifications

• Accession Number: O14924
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6002
• Name: Human RGS12 (aa 233-321) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200016K18Rik; 4632412M04Rik; AI481290; DKFZp761K1617; DKFZp761K1817; E130309H11; regulator of G-protein signaling 12; regulator of G-protein signalling 12; Rgs12; RP11-529E10.1
• Common Name: RGS12
• Gene Symbol: RGS12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTND
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining