Invitrogen™ Human RGS11 (aa 177-264) Control Fragment Recombinant Protein

Product Code. 30181889

Brand: Invitrogen™ RP98614

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60210 (PA5-60210. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Specifications

• Accession Number: O94810
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8786
• Name: Human RGS11 (aa 177-264) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AC004754.2; C78048; regulator of G-protein signaling 11; regulator of G-protein signalling 11; RGS11; RS11
• Common Name: RGS11
• Gene Symbol: RGS11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining