missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201496

Invitrogen™ Human RGPD5 (aa 864-904) Control Fragment Recombinant Protein

Product Code. 30201496
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201496

Brand: Invitrogen™ RP104397

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61078 (PA5-61078. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RANBP2-like and GRIP domain containing 5 protein (RGPD5) has high similarity to RANBP2, a large RAN-binding protein localized at the cytoplasmic side of the nuclear pore complex. The gene coding for RGPD5 is thought to have arisen from a gene duplication event of RANBP2 as these highly homologous genes are located close to each other at chromosome 2q11-q12. RGPD5 was identified as an HIV dependency factor (HDF), suggesting that RGPD5 may be an important drug target in HIV treatment. At least two isoforms of RGPD5 are known to exist, of which the shorter isoform is expressed primarily in testis, while the longer of the two is expressed at low levels in a number of somatic tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99666
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84220
Name Human RGPD5 (aa 864-904) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BS63; BS-63; epididymis luminal protein 161; HEL161; ran-binding protein 2-like 1; ran-binding protein 2-like 1/2; RANBP2L1; RANBP2L2; ranBP2-like 1; ranBP2-like 1/2; RANBP2-like and GRIP domain containing 5; RANBP2-like and GRIP domain-containing protein 5; RANBP2-like and GRIP domain-containing protein 5/6; RANBPL1; RGP5; RGP6; RGP7; RGPD5; RGPD6; RGPD7; Sperm membrane protein BS-63
Common Name RGPD5
Gene Symbol RGPD5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.