Invitrogen™ Human RGL2 (aa 142-214) Control Fragment Recombinant Protein

Product Code. 30181770

Brand: Invitrogen™ RP99591

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62791 (PA5-62791. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro.

Specifications

• Accession Number: O15211
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5863
• Name: Human RGL2 (aa 142-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GDS-related protein; HKE1.5; KE1.5; RAB2L; ral guanine nucleotide dissociation stimulator like 2; ral guanine nucleotide dissociation stimulator,-like 2; ral guanine nucleotide dissociation stimulator-like 2; RalGDS-like 2; ralGDS-like factor; Ras-associated protein RAB2L; Rgl2; Rgt2; Rlf
• Common Name: RGL2
• Gene Symbol: RGL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining