missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202257

Invitrogen™ Human RG9MTD1 (aa 8-95) Control Fragment Recombinant Protein

Product Code. 30202257
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202257

Brand: Invitrogen™ RP96461

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57762 (PA5-57762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the precursor of a subunit of the mitochondrial ribonuclease P, which is involved in 5' processing of mitochondrial tRNAs. The encoded protein may confer RNA-binding capacity to mitochondrial ribonuclease P and may be essential for transcript processing, RNA modification, translation and mitochondrial respiration.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7L0Y3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54931
Name Human RG9MTD1 (aa 8-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias COXPD30; FLJ20432; HBV pre-S2 trans-regulated protein 2; HNYA; mitochondrial ribonuclease P protein 1; Mitochondrial RNase P protein 1; mitochondrial RNase P subunit 1; mRNA methyladenosine-N(1)-methyltransferase; MRPP1; Renal carcinoma antigen NY-REN-49; RG9MTD1; RNA (guanine-9-) methyltransferase domain containing 1; RNA (guanine-9-)-methyltransferase domain-containing protein 1; TRMT10C; tRNA (adenine(9)-N(1))-methyltransferase; tRNA (guanine(9)-N(1))-methyltransferase; tRNA methyltransferase 10 homolog C; tRNA methyltransferase 10 C, mitochondrial RNase P subunit
Common Name RG9MTD1
Gene Symbol TRMT10C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.