Invitrogen™ Human RFX4 (aa 542-626) Control Fragment Recombinant Protein

Product Code. 30212162

Brand: Invitrogen™ RP101198

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62205 (PA5-62205. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.

Specifications

• Accession Number: Q33E94
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5992
• Name: Human RFX4 (aa 542-626) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933412G19Rik; NYD-sp10; Regulatory factor x 4; regulatory factor x 4 protein; regulatory factor X, 4 (influences HLA class II expression); regulatory factor X4; RF x 4; RGD1562092; Testis development protein NYD-SP10; transcription factor RF x 4; winged-helix transcription factor RF x 4
• Common Name: RFX4
• Gene Symbol: RFX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STTGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining