Invitrogen™ Human RFX2 (aa 668-723) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30199358	100 μL	100µL

Product Code. 30199358 Supplier Invitrogen™ Supplier No. RP101139

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61850 (PA5-61850. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: P48378
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5990
• Name: Human RFX2 (aa 668-723) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DNA binding protein RFX2; DNA-binding protein RFX2; FLJ14226; HLA class II regulatory factor RFX2; regulatory factor x 2; regulatory factor X, 2 (influences HLA class II expression); regulatory factor X2; RFX2; trans-acting regulatory factor 2
• Common Name: RFX2
• Gene Symbol: RFX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining