missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RFP2 (aa 158-300) Control Fragment Recombinant Protein

Product Code. 30202779
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202779 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202779 Supplier Invitrogen™ Supplier No. RP94749

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51377 (PA5-51377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by the RFP2 gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. The gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60858
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10206
Name Human RFP2 (aa 158-300) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110001L12Rik; B-cell chronic lymphocytic leukemia tumor suppressor Leu5; CAR; CLL-associated RING finger; DLEU5; E3 ubiquitin-protein ligase TRIM13; LEU5; Leukemia-associated protein 5; putative tumor suppressor RFP2; Ret finger protein 2; Rfp2; RING finger protein 77; RING-type E3 ubiquitin transferase TRIM13; RNF77; TRIM13; tripartite motif containing 13; tripartite motif protein 13; tripartite motif-containing 13; tripartite motif-containing protein 13; tripartite motif-containing protein 13; E3 ubiquitin-protein ligase TRIM13; Unknown (protein for MGC:134296)
Common Name RFP2
Gene Symbol TRIM13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.