Invitrogen™ Human RFP2 (aa 158-300) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30202779	100 μL	100µL

Product Code. 30202779 Supplier Invitrogen™ Supplier No. RP94749

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51377 (PA5-51377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by the RFP2 gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. The gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.

Specifications

• Accession Number: O60858
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10206
• Name: Human RFP2 (aa 158-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110001L12Rik; B-cell chronic lymphocytic leukemia tumor suppressor Leu5; CAR; CLL-associated RING finger; DLEU5; E3 ubiquitin-protein ligase TRIM13; LEU5; Leukemia-associated protein 5; putative tumor suppressor RFP2; Ret finger protein 2; Rfp2; RING finger protein 77; RING-type E3 ubiquitin transferase TRIM13; RNF77; TRIM13; tripartite motif containing 13; tripartite motif protein 13; tripartite motif-containing 13; tripartite motif-containing protein 13; tripartite motif-containing protein 13; E3 ubiquitin-protein ligase TRIM13; Unknown (protein for MGC:134296)
• Common Name: RFP2
• Gene Symbol: TRIM13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining