Invitrogen™ Human RFNG (aa 204-327) Control Fragment Recombinant Protein

Product Code. 30212238

Brand: Invitrogen™ RP90455

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52844 (PA5-52844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase that initiates the elongation of O- linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. May be involved in limb formation and in neurogenesis.

Specifications

• Accession Number: Q9Y644
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5986
• Name: Human RFNG (aa 204-327) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Beta-1,3-N-acetylglucosaminyltransferase radical fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; radical fringe gene homolog; radical fringe homolog; Rfng; RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• Common Name: RFNG
• Gene Symbol: RFNG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPHNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining