missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RFFL (aa 182-266) Control Fragment Recombinant Protein

Product Code. 30200121
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200121

Brand: Invitrogen™ RP92092

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53666 (PA5-53666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has E3 ubiquitin protein ligase activity. Regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity. May bind phosphatidylinositol phosphates.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WZ73
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 117584
Name Human RFFL (aa 182-266) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700051E09Rik; 4930516L10Rik; BG080975; CARP2; CARP-2; caspase regulator CARP2; Caspases-8 and -10-associated RING finger protein 2; E3 ubiquitin-protein ligase rififylin; Fring; FYVE-RING finger protein SAKURA; RFFL; RIFIFYLIN; ring finger and FYVE like domain containing E3 ubiquitin protein ligase; ring finger and FYVE like domain containing protein; ring finger and FYVE-like domain containing 1; ring finger and FYVE-like domain containing E3 ubiquitin protein ligase; RING finger and FYVE-like domain-containing protein 1; RING finger protein 189; RING finger protein 34-like; RING finger protein SAKURA; RING-type E3 ubiquitin transferase rififylin; RNF189; RNF34L
Common Name RFFL
Gene Symbol Rffl
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.