Invitrogen™ Human REV3L (aa 1410-1508) Control Fragment Recombinant Protein

Product Code. 30208779

Brand: Invitrogen™ RP103573

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64186 (PA5-64186. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of the DNA polymerase zeta complex, an error-prone polymerase specialized in translesion DNA synthesis (TLS). Lacks an intrinsic 3'-5' exonuclease activity and thus has no proofreading function.

Specifications

• Accession Number: O60673
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5980
• Name: Human REV3L (aa 1410-1508) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DNA polymerase zeta catalytic subunit; POLZ; Protein reversionless 3-like; Rev; REV3; REV3 like, DNA directed polymerase zeta catalytic subunit; Rev-3, yeast, homolog-like (polymerase, DNA, zeta); Rev3l; REV3-like; REV3-like, catalytic subunit of DNA polymerase zeta; REV3-like, catalytic subunit of DNA polymerase zeta RAD54 like (S. cerevisiae); REV3-like, polymerase (DNA directed), zeta, catalytic subunit; Seizure-related protein 4; Sez4
• Common Name: REV3L
• Gene Symbol: REV3L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining