Invitrogen™ Human RETSAT (aa 28-169) Control Fragment Recombinant Protein

Product Code. 30196243

Brand: Invitrogen™ RP104822

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65443 (PA5-65443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinol saturase carrying out the saturation of the 13-14 double bond of all-trans-retinol to produce all-trans-13,14-dihydroretinol. Has activity toward all-trans-retinol as substrate. Does not use all-trans-retinoic acid nor 9-cis, 11-cis or 13-cis-retinol isomers as substrates. May play a role in the metabolism of vitamin A.

Specifications

• Accession Number: Q6NUM9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54884
• Name: Human RETSAT (aa 28-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: All-trans-13,14-dihydroretinol saturase; all-trans-retinol 13,14-reductase; PPAR-alpha-regulated and starvation-induced gene protein; PPSIG; retinol saturase; retinol saturase (all-trans-retinol 13,14-reductase); RETSAT; UNQ439/PRO872
• Common Name: RETSAT
• Gene Symbol: RETSAT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFSANQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining