Invitrogen™ Human RET (aa 702-848) Control Fragment Recombinant Protein

Product Code. 30195278

Brand: Invitrogen™ RP89529

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The receptor tyrosine kinase RET is a member of the cadherin superfamily. RET plays a crucial role in neural crest development, and can undergo oncogenic activation by cytogenetic rearrangement. RET transduce signals for cell growth and differentiation. Mutations in the RET gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for the RET gene. Additional transcript variants have been described for RET but their biological validity has not been confirmed.

Specifications

• Accession Number: P07949
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5979
• Name: Human RET (aa 702-848) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cadherin family member 12; Cadherin family member 12 (CDHF12); Cadherin related family member 16 (CDHR16); cadherin-related family member 16; CDHF12; CDHR16; CG1061; CG14396; CG14396-PA; CG14396-PB; CG14396-PC; c-Ret; CU x 1/RET fusion; Dmel\CG14396; Dmel_CG14396; DmHD-59; DmRet; Dret; D-ret; EC 2.7.10.1; ELKS; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment; HD-59; HSCR1; Hydroxyaryl protein kinase; hydroxyaryl-protein kinase; kinase Ret; MEN2; MEN2A; MEN2B; MTC1; Multiple endocrine neoplasia and medullary thyroid carcinoma 1; Oncogene RET; OTTHUMP00000216967; proto-oncogene c-Ret; Proto-oncogene tyrosine-protein kinase receptor Ret; PTC; rearranged during transfection; receptor tyrosine kinase; ret; RET ELE1; Ret gene for receptor tyrosin; Ret oncogene; ret proto-oncogene; ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease); Ret proto-oncogene (multiple endocrine neoplasia MEN2A MEN2B and medullary thyroid carcinoma 1 Hirschsprung disease); RET receptor tyrosine kinase; RET transforming sequence; RET51; RET9; RET-ELE1; Reto; Ret-PA; Ret-PB; Ret-PC; Soluble RET kinase fragment
• Common Name: RET
• Gene Symbol: RET
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining