Invitrogen™ Human RelB (aa 186-329) Control Fragment Recombinant Protein

Product Code. 30201398

Brand: Invitrogen™ RP89314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The NFkB transcription factor was originally identified as a protein complex consisting of a DNA-binding subunit and an associated protein. The DNAbinding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A second protein designated p52 (previously referred to as p49) has been identified that can act as an alternative NFkB subunit. Rel B does not bind with high affinity to NFkB sites, but heterodimers between Rel B and p50 bind with an affinity comparable to that of p50 NFkB homodimers. However, Rel B/p50 heterodimers, in contrast to NFkB heterodimers, transactivates transcription of promotors containing kB binding sites.

Specifications

• Accession Number: Q01201
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5971
• Name: Human RelB (aa 186-329) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: avian reticuloendotheliosis viral (v-rel) oncogene related B; IREL; I-REL; OTTHUMP00000221313; rel b; RELB; REL-B; RELB proto-oncogene, NF-kB subunit; shep; transcription factor RelB; v-rel avian reticuloendotheliosis viral oncogene homolog B; v-rel avian reticuloendotheliosis viral oncogene homolog B (nuclear factor of kappa light polypeptide gene enhancer in B-cells 3); v-rel reticuloen; v-rel reticuloendotheliosis viral oncogene homolog B; v-rel reticuloendotheliosis viral oncogene homolog B, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3
• Common Name: RelB
• Gene Symbol: RELB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining