Invitrogen™ Human Relaxin 3 (aa 91-142) Control Fragment Recombinant Protein

Product Code. 30182313

Brand: Invitrogen™ RP99174

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60485 (PA5-60485. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Relaxin 3 is part of the Relaxin-like peptide family that plays an important neuropeptide signaling role. Relaxin 3 is a ligand for two structurally related G protein-coupled receptors, human Relaxin receptor 3 and Relaxin receptor 4. The greatest levels of Relaxin 3 expression occur in the brain, specifically in the pons/medulla, with highest levels in the pars ventromedialis of the dorsal tegmental nucleus and with lower levels in the hippocampus and olfactory regions. Significant expression is also observed in the spleen, thymus, lung and ovary. Relaxin 3 inhibits Forskolin-stimulated cAMP accumulation in a dose-dependent manner in cells that express Relaxin receptor 3. Acute and repeated administration of Relaxin 3 causes a decrease in levels of the plasma thyroid stimulating hormone, suggesting that Relaxin 3 may play a role in long-term control of food intake.

Specifications

• Accession Number: Q8WXF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 117579
• Name: Human Relaxin 3 (aa 91-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: H3; insl7; insulin-like 7; insulin-like peptide 7; Insulin-like peptide INSL7; M3; PRO20213; Prorelaxin H3; prorelaxin M3; relaxin 3; relaxin-3; Relaxin-3 A chain; Relaxin-3 B chain; RLN3; RXN3; UNQ6188; UNQ6188/PRO20213; ZINS4
• Common Name: Relaxin 3
• Gene Symbol: RLN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining