missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203651

Invitrogen™ Human REG4 (aa 90-158) Control Fragment Recombinant Protein

Product Code. 30203651
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203651

Brand: Invitrogen™ RP102992

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61248 (PA5-61248. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reg IV is part of the regenerating gene family within the C-type lectin superfamily. This family is involved in liver, pancreatic, gastric and intestinal cell proliferation and differentiation. Reg IV is a 158-amino acid secretory protein implicated in cell regeneration and/or survival with a definite growth stimulating effect on pancreatic beta cells. It is highly expressed in colorectal, gastric, prostate and other types of cancer. Reg IV-positive tumor cells display different phenotypes including mucus-secreting, enterocyte-like, and undifferentiated.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BYZ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83998
Name Human REG4 (aa 90-158) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010002L15Rik; Gastrointestinal secretory protein; GISP; GISPREG-4; Reg IV; REG4; REG-4; regenerating family member 4; regenerating gene type IV; regenerating islet-derived family, member 4; regenerating islet-derived protein 4; Regenerating islet-derived protein IV; REG-IV; REG-like protein; RELP
Common Name REG4
Gene Symbol REG4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.