Invitrogen™ Human REG1A (aa 93-125) Control Fragment Recombinant Protein

Product Code. 30180972

Brand: Invitrogen™ RP99484

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61038 (PA5-61038. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.

Specifications

• Accession Number: P05451
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5967
• Name: Human REG1A (aa 93-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ICRF; islet cells regeneration factor; Islet of Langerhans regenerating protein; LITHOST; Lithostathine; lithostathine 1 alpha; lithostathine-1-alpha; MGC12447; P19; pancreatic stone protein; pancreatic stone protein, secretory; pancreatic thread protein; protein-X; PSP; PSPS; PSPS1; PTP; RATLITHOST; RATRGPI; Reg; Reg1; REG1A; REG-1-alpha; regenerating family member 1 alpha; regenerating islet-derived 1 alpha; regenerating islet-derived mouse homolog 1; regenerating islet-derived protein 1-alpha; Regenerating protein I alpha; regeneration protein, lithostatin, pancreatic stone protein; Rgp1; RGPI
• Common Name: REG1A
• Gene Symbol: REG1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining