Invitrogen™ Human RECK (aa 419-494) Control Fragment Recombinant Protein

Product Code. 30209836

Brand: Invitrogen™ RP107834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111679 (PA5-111679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RECK is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis.

Specifications

• Accession Number: O95980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8434
• Name: Human RECK (aa 419-494) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hRECK; membrane-anchored glycoprotein (metastasis and invasion); membrane-anchored glycoprotein RECK; mRECK; RECK; reversion inducing cysteine rich protein with kazal motifs; reversion-inducing cysteine-rich protein with Kazal motifs; Reversion-inducing cysteine-rich protein with Kazal motifs precursor (mRECK); reversion-inducing-cysteine-rich protein with kazal motifs; ST15; suppression of tumorigenicity 15; suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein with kazal motifs); suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein with kazal motifs); suppressor of tumorigenicity 15 protein
• Common Name: RECK
• Gene Symbol: RECK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining