missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human REC8 (aa 409-507) Control Fragment Recombinant Protein

Product Code. 30194972
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194972

Brand: Invitrogen™ RP95576

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56836 (PA5-56836. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95072
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9985
Name Human REC8 (aa 409-507) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cohesin Rec8p; cohesion rec8p; HR21spB; human homolog of rad21, S. pombe; kleisin-alpha; Mei8; meiosis specific sister chromatid cohesion protein; meiotic cohesion Rec8; meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family; meiotic recombination protein REC8 homolog; meiotic recombination protein REC8-like 1; mrec; Rec8; rec8 {ECO:0000250; REC8 homolog; REC8 meiotic recombination protein; Rec8L1; REC8-like 1; Rec8p; recombination and sister chromatid cohesion protein homolog; UniProtKB:Q8C5S7}
Common Name REC8
Gene Symbol REC8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.