Invitrogen™ Human REC8 (aa 409-507) Control Fragment Recombinant Protein

Product Code. 30194972

Brand: Invitrogen™ RP95576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56836 (PA5-56836. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: O95072
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9985
• Name: Human REC8 (aa 409-507) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cohesin Rec8p; cohesion rec8p; HR21spB; human homolog of rad21, S. pombe; kleisin-alpha; Mei8; meiosis specific sister chromatid cohesion protein; meiotic cohesion Rec8; meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family; meiotic recombination protein REC8 homolog; meiotic recombination protein REC8-like 1; mrec; Rec8; rec8 {ECO:0000250; REC8 homolog; REC8 meiotic recombination protein; Rec8L1; REC8-like 1; Rec8p; recombination and sister chromatid cohesion protein homolog; UniProtKB:Q8C5S7}
• Common Name: REC8
• Gene Symbol: REC8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining