Invitrogen™ Human RDH8 (aa 239-299) Control Fragment Recombinant Protein

Product Code. 30204294

Brand: Invitrogen™ RP109062

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139867 (PA5-139867. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity.

Specifications

• Accession Number: Q9NYR8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50700
• Name: Human RDH8 (aa 239-299) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm182; LOW QUALITY PROTEIN: retinol dehydrogenase 8; photoreceptor outer segment all-trans retinol dehydrogenase; PRRDH; Rdh8; Retinol dehydrogenase 8; retinol dehydrogenase 8 (all-trans); SDR28C2; Short chain dehydrogenase/reductase family 28 C member 2; short chain dehydrogenase/reductase family 28 C, member 2; visual cycle enzyme that reduces all-trans retinal to all-trans retinol
• Common Name: RDH8
• Gene Symbol: RDH8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining