Invitrogen™ Human RDH13 (aa 220-291) Control Fragment Recombinant Protein

Artikelnummer. 30181395

Marke: Invitrogen™ RP99103

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59818 (PA5-59818. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Does not exhibit retinol dehydrogenase (RDH) activity in vitro.

Spezifikation

• Accession Number: Q8NBN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112724
• Name: Human RDH13 (aa 220-291) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430425D21Rik; PSEC0082; Rdh13; Retinol dehydrogenase 13; retinol dehydrogenase 13 (all-trans and 9-cis); retinol dehydrogenase 13 (all-trans/9-cis); SDR7C3; Short chain dehydrogenase/reductase family 7 C member 3; short chain dehydrogenase/reductase family 7 C, member 3; UNQ736/PRO1430
• Common Name: RDH13
• Gene Symbol: Rdh13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining