Invitrogen™ Human RC3H1 (aa 884-982) Control Fragment Recombinant Protein

Product Code. 30194725

Brand: Invitrogen™ RP94234

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55612 (PA5-55612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ring finger protein RC3H1, also known as Roquin, is a highly conserved member of the RING type ubiquitin ligase protein family whose M199R mutation leads to the excessive production of follicular helper T cells and germinal centers in the sanroque strain of mice, a strain with excessive IL-21 production and high titers of autoantibodies. The complete loss of RC3H1 induces early death and immune deregulation but not autoimmunity in RC3H1-null mice, suggesting that the mutant RC3H1 is more disruptive to the immune system than its complete loss.

Specifications

• Accession Number: Q5TC82
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 149041
• Name: Human RC3H1 (aa 884-982) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730557L09Rik; Gm551; Kiaa2025; mKIAA2025; N28103; probable E3 ubiquitin-protein ligase Roquin; protein Sanroque; RC3H1; RGD1563512; RING CCCH (C3H) domains 1; RING finger and C3H zinc finger protein 1; ring finger and CCCH-type domains 1; RING finger and CCCH-type zinc finger domain-containing protein 1; ring finger and CCCH-type zinc finger domains 1; RING finger protein 198; RNF198; ROQUIN; Roquin-1
• Common Name: RC3H1
• Gene Symbol: RC3H1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTSKTIYQGAGPMQAMAPQGAPTKSINISDYSPYGTHGGWGASPYSPHQNIPSQGHFSERERISMSEVASHGKPLPSAEREQLRLELQQLNHQISQQTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining