missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RC3H1 (aa 437-523) Control Fragment Recombinant Protein

Product Code. 30211291
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211291

Brand: Invitrogen™ RP94232

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55615 (PA5-55615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ring finger protein RC3H1, also known as Roquin, is a highly conserved member of the RING type ubiquitin ligase protein family whose M199R mutation leads to the excessive production of follicular helper T cells and germinal centers in the sanroque strain of mice, a strain with excessive IL-21 production and high titers of autoantibodies. The complete loss of RC3H1 induces early death and immune deregulation but not autoimmunity in RC3H1-null mice, suggesting that the mutant RC3H1 is more disruptive to the immune system than its complete loss.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5TC82
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 149041
Name Human RC3H1 (aa 437-523) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730557L09Rik; Gm551; Kiaa2025; mKIAA2025; N28103; probable E3 ubiquitin-protein ligase Roquin; protein Sanroque; RC3H1; RGD1563512; RING CCCH (C3H) domains 1; RING finger and C3H zinc finger protein 1; ring finger and CCCH-type domains 1; RING finger and CCCH-type zinc finger domain-containing protein 1; ring finger and CCCH-type zinc finger domains 1; RING finger protein 198; RNF198; ROQUIN; Roquin-1
Common Name RC3H1
Gene Symbol RC3H1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.