missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194470

Invitrogen™ Human RBPJ (aa 409-500) Control Fragment Recombinant Protein

Product Code. 30194470
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194470

Brand: Invitrogen™ RP107026

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CSL plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. The protein is abundantly expressed in heart and skeletal muscle and expression is increased by passive stretch. Mutations in this gene can lead to X-linked deafness.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06330
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3516
Name Human RBPJ (aa 409-500) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI843960; AOS3; CBF1; CBF-1; csl; H-2 K binding factor-2; Igkjrb; Igkjrb1; Igkrsbp; immunoglobulin kappa J region recombination signal binding protein 1; J kappa-recombination signal-binding protein; KBF2; Rbpj; RBP-J; RBP-J kappa; RBPJK; RBP-JK; rbp-jkappa; RBPSUH; recombination signal binding protein for immunoglobulin kappa J region; recombining binding protein suppressor of hairless; recombining binding protein suppressor of hairless-like; recombining binding protein suppressor of hairless-like protein; renal carcinoma antigen NY-REN-30; SUH; suppressor of hairless homolog; Unknown (protein for MGC:128782)
Common Name RBPJ
Gene Symbol RBPJ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.