Invitrogen™ Human RBP7 (aa 31-102) Control Fragment Recombinant Protein

Product Code. 30180907

Brand: Invitrogen™ RP97579

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57043 (PA5-57043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.

Specifications

• Accession Number: Q96R05
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116362
• Name: Human RBP7 (aa 31-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110002J23Rik; cellular retinoic acid-binding protein 4; Cellular retinoic acid-binding protein IV; cellular retinol binding protein 7; cellular retinol binding protein type III; CRABP4; CRABP-IV; CRBP4; CRBP-III; CRBPIV; cytosolic binding protein; putative cellular retinol-binding protein CRBP IV; RBP7; retinoid binding protein 7; retinoid-binding protein 7; retinol binding protein 7; retinol binding protein 7, cellular; RGD1562168
• Common Name: RBP7
• Gene Symbol: Rbp7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining