missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RBP2 (aa 31-96) Control Fragment Recombinant Protein

Product Code. 30206691
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30206691

missing translation for 'mfr': Invitrogen™ RP96282

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57438 (PA5-57438. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P50120
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5948
Name Human RBP2 (aa 31-96) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409370; C76986; Cellular retinol-binding protein II; CRABP-II; CRBP2; Crbp-2; CrbpII; CRBP-II; Histone demethylase JARID1A; Jarid1a; jumonji, AT rich interactive domain 1 A (Rbp2 like); Jumonji, AT rich interactive domain 1 A (RBP2-like); jumonji/ARID domain-containing protein 1 A; KDM5A; lysine (K)-specific demethylase 5 A; lysine demethylase 5 A; lysine-specific demethylase 5 A; RBBP2; RBBP-2; RBP2; Rbp-2; RBPC2; retinoblastoma binding protein 2; retinoblastoma-binding protein 2; retinol binding protein 2; retinol binding protein 2, cellular; retinol-binding protein 2; Retinol-binding protein 2 cellular; retinol-binding protein 2, cellular
Common Name RBP2
Gene Symbol RBP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.