Invitrogen™ Human RBM7 (aa 195-253) Control Fragment Recombinant Protein

Product Code. 30210713

Brand: Invitrogen™ RP103011

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61633 (PA5-61633. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.

Specifications

• Accession Number: Q9Y580
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10179
• Name: Human RBM7 (aa 195-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200007M24Rik; 1500011D06Rik; AU041934; AW554393; RBM7; RNA binding motif protein 7; rna-binding; RNA-binding motif protein 7; RNA-binding protein 7
• Common Name: RBM7
• Gene Symbol: RBM7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining