Invitrogen™ Human RBM27 (aa 687-780) Control Fragment Recombinant Protein

Product Code. 30212674

Brand: Invitrogen™ RP96862

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57475 (PA5-57475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM27 gene ontology annotations related to this gene include mRNA processing; positive regulation of RNA export from nucleus.

Specifications

• Accession Number: Q9P2N5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54439
• Name: Human RBM27 (aa 687-780) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730010I06; acidic rich RS domain containing 1; AI043120; ARRS1; Kiaa1311; mKIAA1311; peri implantation stem cell 1; periimplantation stem cell 1; peri-implantation stem cell protein 1; Psc1; RBM27; RNA binding motif protein 27; RNA-binding motif protein 27; RNA-binding protein 27; ZC3H18; ZC3H20
• Common Name: RBM27
• Gene Symbol: RBM27
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQIFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining