Invitrogen™ Human RBM25 (aa 29-116) Control Fragment Recombinant Protein

Product Code. 30193858

Brand: Invitrogen™ RP107768

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67122 (PA5-67122. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding protein that acts as a regulator of alternative pre-mRNA splicing. Involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression. Modulates the ratio of proapoptotic BCL2L1 isoform S to antiapoptotic BCL2L1 isoform L mRNA expression. When overexpressed, stimulates proapoptotic BCL2L1 isoform S 5'-splice site (5'-ss) selection, whereas its depletion caused the accumulation of antiapoptotic BCL2L1 isoform L. Promotes BCL2L1 isoform S 5'-ss usage through the 5'-CGGGCA-3' RNA sequence. Its association with LUC7L3 promotes U1 snRNP binding to a weak 5' ss in a 5'-CGGGCA-3'-dependent manner. Binds to the exonic splicing enhancer 5'-CGGGCA-3' RNA sequence located within exon 2 of the BCL2L1 pre-mRNA. Also involved in the generation of an abnormal and truncated splice form of SCN5A in heart failure.

Specifications

• Accession Number: P49756
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58517
• Name: Human RBM25 (aa 29-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2600011C06Rik; 2610015J01Rik; A130095G20Rik; AI159652; AL023075; arg/Glu/Asp-rich protein of 120 kDa; Arg/Glu/Asp-rich protein, 120 kDa; AU043498; fSAP94; functional spliceosome-associated protein 94; LOC540258 protein; NET52; Protein S164; Rbm25; RED120; RNA binding motif protein 25; rna-binding; RNA-binding motif protein 25; RNA-binding protein 25; RNA-binding protein 25-like protein; RNA-binding region (RNP1, RRM) containing 7; RNA-binding region-containing protein 7; RNPC7; S164; Snu71; U1 small nuclear ribonucleoprotein 1 SNRP homolog
• Common Name: RBM25
• Gene Symbol: RBM25
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining