Invitrogen™ Human RBM15B (aa 255-336) Control Fragment Recombinant Protein

Product Code. 30201859

Brand: Invitrogen™ RP105092

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66136 (PA5-66136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function in the regulation of alternative or illicit splicing.

Specifications

• Accession Number: Q8NDT2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29890
• Name: Human RBM15B (aa 255-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810017N16Rik; chromosome 3p21.1 gene sequence; HsOTT3; HUMAGCGB; huOTT3; one twenty two protein 3; one-twenty two protein 3; OTT3; putative RNA-binding protein 15 B; Rbm15b; RGD1305937; RNA binding motif protein 15 pseudogene; RNA binding motif protein 15 B; rna-binding; RNA-binding motif protein 15 B
• Common Name: RBM15B
• Gene Symbol: RBM15B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining