Invitrogen™ Human RBL1 (aa 325-379) Control Fragment Recombinant Protein

Product Code. 30199871

Brand: Invitrogen™ RP101722

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84301 (PA5-84301. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RB-like 1 is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and RB-like 1 can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that RB-like 1 may also be a tumor suppressor.

Specifications

• Accession Number: P28749
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5933
• Name: Human RBL1 (aa 325-379) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 107 kDa retinoblastoma-associated protein; AW547426; CP107; DNA-binding protein RF x 5; MGC40006; p107; pRb1; RB transcriptional corepressor like 1; Rbl1; Regulatory factor x 5; regulatory factor X, 5 (influences HLA class II expression); regulatory factor X5; retinoblastoma-like 1; retinoblastoma-like 1 (p107); retinoblastoma-like protein 1; RF x 5
• Common Name: RBL1
• Gene Symbol: RBL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTGRRYLRE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining