Invitrogen™ Human RBKS (aa 131-226) Control Fragment Recombinant Protein

Product Code. 30207857

Brand: Invitrogen™ RP91760

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83006 (PA5-83006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBSK belongs to the pfkB family of carbohydrate kinases. It phosphorylates ribose to form ribose-5-phosphate in the presence of ATP and magnesium as a first step in ribose metabolism.

Specifications

• Accession Number: Q9H477
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64080
• Name: Human RBKS (aa 131-226) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5230400M11Rik; RBKS; RBSK; Ribokinase; RK
• Common Name: RBKS
• Gene Symbol: RBKS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining