Invitrogen™ Human RBG1L (aa 2-56) Control Fragment Recombinant Protein

Product Code. 30181821

Brand: Invitrogen™ RP99805

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63009 (PA5-63009. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RABGAP1L is a protein coding gene.

Specifications

• Accession Number: B7ZAP0, Q5R372
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9910
• Name: Human RBG1L (aa 2-56) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830411O09Rik; 8430421H08Rik; 9630005B12Rik; AW049894; expressed in hematopoietic cells, heart, liver (HLL); Hh1; Hhl; Kiaa0471; mKIAA0471; RAB GTPase activating protein 1 like; RAB GTPase activating protein 1-like; rab GTPase-activating protein 1-like; Rab GTPase-activating protein 1-like, isoform 10; RAB GTPase-activating protein 1-like-like protein; rab6 GTPase activating protein-like; RABGAP1L; RGD1304620; TBC1 domain family, member 18; TBC1D18
• Common Name: RBG1L
• Gene Symbol: Rabgap1l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining