missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RBFOX2 (aa 24-93) Control Fragment Recombinant Protein

Product Code. 30210206
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210206

Brand: Invitrogen™ RP91544

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52268 (PA5-52268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43251
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23543
Name Human RBFOX2 (aa 24-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dJ106I20.3; Fbm2; fox-1 homolog B; Fox-1 homolog Fxh; fox-1 homologue; FO x 2; Fox-2; Fxh; Fyn-binding molecule 2; hexaribonucleotide-binding protein 2; HNRBP2; Hrnbp2; Rbfo x 2; Rbm9; repressor of tamoxifen transcriptional activity; RNA binding fox-1 homolog 2; RNA binding motif protein 9; RNA binding protein fox-1 homolog 2; RNA binding protein fox-1 homolog 2; RNA binding protein, fox-1 homolog (C. elegans) 2; RNA binding protein, fox-1 homolog (C. elegans) 2; RNA binding protein, fox-1 homolog 2; RNA-binding motif protein 9; RNA-binding protein 9; RTA; zgc:85694
Common Name RBFOX2
Gene Symbol RBFOX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.