Invitrogen™ Human RBCK1 (aa 60-192) Control Fragment Recombinant Protein

Product Code. 30211416

Brand: Invitrogen™ RP102083

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55006 (PA5-55006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBCK1 encodes a protein that is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms.

Specifications

• Accession Number: Q9BYM8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10616
• Name: Human RBCK1 (aa 60-192) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL033326; C20orf18; HBV-associated factor 4; heme-oxidized IRP2 ubiquitin ligase 1; Heme-oxidized IRP2 ubiquitin ligase 1 homolog; hepatitis B virus X-associated protein 4; HOIL1; HOIL-1; HOIL-1 L; novel zinc finger, C3HC4 type (RING finger) protein; PBMEI; PGBM1; Pkcbpb15; protein kinase C-binding protein Beta15; protein kinase C-binding protein beta-15; RANBP2-type and C3HC4-type zinc finger containing 1; RanBP-type and C3HC4-type zinc finger containing 1; ranBP-type and C3HC4-type zinc finger-containing protein 1; RBCC protein interacting with PKC; RBCC protein interacting with PKC 1; RBCC protein interacting with PKC1; Rbck; RBCK1; RBCK2; RING finger protein 54; RING-type E3 ubiquitin transferase HOIL-1; RNF54; UBCE7IP3; ubcM4-interacting protein 28; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3; Uip28; XAP3; XAP4; ZRANB4
• Common Name: RBCK1
• Gene Symbol: RBCK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining