missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RBCK1 (aa 60-192) Control Fragment Recombinant Protein

Product Code. 30211416
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211416

Brand: Invitrogen™ RP102083

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55006 (PA5-55006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBCK1 encodes a protein that is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BYM8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10616
Name Human RBCK1 (aa 60-192) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL033326; C20orf18; HBV-associated factor 4; heme-oxidized IRP2 ubiquitin ligase 1; Heme-oxidized IRP2 ubiquitin ligase 1 homolog; hepatitis B virus X-associated protein 4; HOIL1; HOIL-1; HOIL-1 L; novel zinc finger, C3HC4 type (RING finger) protein; PBMEI; PGBM1; Pkcbpb15; protein kinase C-binding protein Beta15; protein kinase C-binding protein beta-15; RANBP2-type and C3HC4-type zinc finger containing 1; RanBP-type and C3HC4-type zinc finger containing 1; ranBP-type and C3HC4-type zinc finger-containing protein 1; RBCC protein interacting with PKC; RBCC protein interacting with PKC 1; RBCC protein interacting with PKC1; Rbck; RBCK1; RBCK2; RING finger protein 54; RING-type E3 ubiquitin transferase HOIL-1; RNF54; UBCE7IP3; ubcM4-interacting protein 28; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3; Uip28; XAP3; XAP4; ZRANB4
Common Name RBCK1
Gene Symbol RBCK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.