missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206705

Invitrogen™ Human RBBP9 (aa 117-186) Control Fragment Recombinant Protein

Product Code. 30206705
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206705

Brand: Invitrogen™ RP106211

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75884
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10741
Name Human RBBP9 (aa 117-186) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B5T overexpressed gene protein; B5T-overexpressed gene protein; BOG; im:7247963; im:7247963 protein; MGC9236; Protein BOG; Putative hydrolase RBBP9; RB binding protein 9, serine hydrolase; RBBP10; RBBP-10; Rbbp9; RBBP-9; retinoblastoma binding protein 9; retinoblastoma-binding protein 10; Retinoblastoma-binding protein 9; retinoma-binding protein 9; serine hydrolase RBBP9; serine hydrolase RBBP9; putative hydrolase RBBP9; si:ch211-258l4.7; zgc:152807
Common Name RBBP9
Gene Symbol RBBP9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.