Invitrogen™ Human RBBP9 (aa 117-186) Control Fragment Recombinant Protein

Artikelnummer. 30206705

missing translation for 'mfr': Invitrogen™ RP106211

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.

Spezifikation

• Accession Number: O75884
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10741
• Name: Human RBBP9 (aa 117-186) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B5T overexpressed gene protein; B5T-overexpressed gene protein; BOG; im:7247963; im:7247963 protein; MGC9236; Protein BOG; Putative hydrolase RBBP9; RB binding protein 9, serine hydrolase; RBBP10; RBBP-10; Rbbp9; RBBP-9; retinoblastoma binding protein 9; retinoblastoma-binding protein 10; Retinoblastoma-binding protein 9; retinoma-binding protein 9; serine hydrolase RBBP9; serine hydrolase RBBP9; putative hydrolase RBBP9; si:ch211-258l4.7; zgc:152807
• Common Name: RBBP9
• Gene Symbol: RBBP9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining