Invitrogen™ Human RBBP6 (aa 1295-1383) Control Fragment Recombinant Protein

Artikelnummer. 30202936

Marke: Invitrogen™ RP106045

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111180 (PA5-111180. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cilia-associated protein belonging to the kinesin family. This protein plays a role in the sonic hedgehog (SHH) signaling pathway through the regulation of GLI transcription factors. It functions as a negative regulator of the SHH pathway by preventing inappropriate activation of GLI2 in the absence of ligand, and as a positive regulator by preventing the processing of GLI3 into its repressor form. Mutations in this gene have been associated with various ciliopathies.

Spezifikation

• Accession Number: Q7Z6E9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5930
• Name: Human RBBP6 (aa 1295-1383) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933422O15Rik; AI316869; BB233631; C030034J04Rik; C77662; E3 ubiquitin-protein ligase RBBP6; im:7158869; MY038; my038-like; P2PR; P2P-R; p53-associated cellular protein of testis; PACT; Proliferation potential-related protein; protein P2P-R; RB binding protein 6, ubiquitin ligase; RB-binding Q-protein 1; Rbbp6; rbbp6l; RBQ1; RBQ-1; retinoblastoma binding protein 6; retinoblastoma-binding protein 6; retinoblastoma-binding protein 6, isoform 3; retinoblastoma-binding Q protein 1; RING-type E3 ubiquitin transferase RBBP6; SNAMA
• Common Name: RBBP6
• Gene Symbol: Rbbp6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining