Human/Rat Osteocalcin Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 24 publications

Brand:  R&D Systems MAB1419-SP

Product Code. 18743327

Description

Osteocalcin Monoclonal specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready.

Specifications

• Antigen: Osteocalcin
• Classification: Monoclonal
• Concentration: LYOPH
• Dilution: Immunohistochemistry 8-25 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, Immunocytochemistry 8-25 ug/mL, CyTOF-ready
• Gene Accession No.: P02818
• Gene Symbols: BGLAP
• Immunogen: Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
• Quantity: 25 μg
• Primary or Secondary: Primary
• Test Specificity: Detects human Osteocalcin in direct ELISAs.
• Target Species: Human, Rat
• Form: Purified

• Applications: Immunohistochemistry, Flow Cytometry, Immunocytochemistry, CyTOF
• Clone: 190125
• Conjugate: Unconjugated
• Formulation: Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
• Gene Alias: BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
• Host Species: Mouse
• Purification Method: Protein A or G purified from hybridoma culture supernatant
• Regulatory Status: RUO
• Gene ID (Entrez): 632
• Reconstitution: Reconstitute at 0.5 mg/mL in sterile PBS.
• Content And Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
• Isotype: IgG1

For Research Use Only