Human/Rat Osteocalcin Alexa Fluor 750-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody

Brand:  R&D Systems IC1419S-100UG

Product Code. 18730349

Description

Osteocalcin Monoclonal specifically detects Osteocalcin in Human, Rat samples. It is validated for Intracellular Staining by Flow Cytometry.

Specifications

• Antigen: Osteocalcin
• Classification: Monoclonal
• Concentration: 0.2 mg/mL
• Dilution: Intracellular Staining by Flow Cytometry 0.25-1 ug/10^6 cells
• Gene Accession No.: P02818
• Gene Symbols: BGLAP
• Immunogen: Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
• Regulatory Status: RUO
• Gene ID (Entrez): 632
• Target Species: Human, Rat
• Isotype: IgG1

• Applications: Flow Cytometry
• Clone: 190125
• Conjugate: Alexa Fluor 750
• Formulation: Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide. with 0.09% Sodium Azide
• Gene Alias: BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Test Specificity: Detects human Osteocalcin in direct ELISAs.
• Content And Storage: Store the unopened product at 2 - 8 degreesC. Do not use past expiration date.

For Research Use Only (RUO)