Invitrogen™ Human RASSF9 (aa 357-435) Control Fragment Recombinant Protein

Product Code. 30182389

Brand: Invitrogen™ RP97893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58785 (PA5-58785. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways.

Specifications

• Accession Number: O75901
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9182
• Name: Human RASSF9 (aa 357-435) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW322107; PAM COOH-terminal interactor protein 1; Pamci; PCIP1; P-cip1; Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor; peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor protein-1; Ras association (RalGDS/AF-6) domain family (N-terminal) member 9; Ras association domain family member 9; ras association domain-containing protein 9; RASSF9
• Common Name: RASSF9
• Gene Symbol: RASSF9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining