Invitrogen™ Human RASSF6 (aa 16-103) Control Fragment Recombinant Protein

Product Code. 30211621

Brand: Invitrogen™ RP104678

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65191 (PA5-65191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RASSF6 is a member of the RAS association domain family of RAS effectors/tumor suppressors that mediate some of the growth inhibitory properties of RAS oncogenes.

Specifications

• Accession Number: Q6ZTQ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 166824
• Name: Human RASSF6 (aa 16-103) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600016B17Rik; DKFZp686K23225; putative RAS binding protein; Ras association (RalGDS/AF-6) domain family 6; Ras association (RalGDS/AF-6) domain family member 6; Ras association domain family member 6; ras association domain-containing protein 6; RASSF6
• Common Name: RASSF6
• Gene Symbol: Rassf6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining