Invitrogen™ Human RASL10B (aa 17-69) Control Fragment Recombinant Protein

Product Code. 30207876

Brand: Invitrogen™ RP103289

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63398 (PA5-63398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May facilitate the release of atrial natriuretic peptide by cardiomyocytes and hence play a role in the regulation of arterial pressure.

Specifications

• Accession Number: Q96S79
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91608
• Name: Human RASL10B (aa 17-69) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alternative protein RASL10B; B230331P10Rik; Gm729; RAS like family 10 member B; Rasl10b; RAS-like family 10 member B; ras-like protein family member 10 B; Ras-like protein VTS58635; RAS-like, family 10, member B; Ras-related protein 17; RRP17; rslab; VTS58635
• Common Name: RASL10B
• Gene Symbol: RASL10B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining