missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RASGRP3 (aa 590-681) Control Fragment Recombinant Protein

Product Code. 30194345
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194345

Brand: Invitrogen™ RP110026

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144784 (PA5-144784. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the RAS subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IV61
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25780
Name Human RASGRP3 (aa 590-681) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC066069; calcium and DAG-regulated guanine nucleotide exchange factor III; calcium- and diacylglycerol-regulated guanine nucleotide exchange factor III; CalDAG-GEFIII; Gm327; GRP3; Guanine nucleotide exchange factor for Rap1; KIAA0846; OTTHUMP00000201245; RAS guanyl releasing protein 3; RAS guanyl releasing protein 3 (calcium and DAG-regulated); ras guanyl-releasing protein 3; RAS, guanyl releasing protein 3; Rasgrp3
Common Name RASGRP3
Gene Symbol Rasgrp3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.