Invitrogen™ Human RASGRP2 (aa 25-139) Control Fragment Recombinant Protein

Product Code. 30206072

Brand: Invitrogen™ RP90658

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82534 (PA5-82534. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q7LDG7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10235
• Name: Human RASGRP2 (aa 25-139) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Calcium and DAG-regulated guanine nucleotide exchange factor I; calcium and diacylglycerol-regulated guanine nucleotide exchange factor I; Caldaggef1; CalDAG-GEFI; CDC25L; cdc25-like protein; F25B3.3 kinase like protein; F25B3.3 kinase-like protein; guanine exchange factor MCG7; hCDC25L; MCG7; RAP 1 A protein-specific guanine nucleotide exchange factor 1; RAS guanyl nucleotide-releasing protein 2; RAS guanyl releasing protein 2; RAS guanyl releasing protein 2 (calcium and DAG-regulated); RAS guanyl-releasing protein 2; RAS, guanyl releasing protein 2; RAS, guanyl releasing protein 2; RAP 1 A protein-specific guanine nucleotide exchange factor 1; CalDAG-GEFI; Rasgrp2
• Common Name: RASGRP2
• Gene Symbol: RASGRP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining