Invitrogen™ Human RASA3 (aa 736-811) Control Fragment Recombinant Protein

Product Code. 30180596

Brand: Invitrogen™ RP98013

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111244 (PA5-111244. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human GAP1-InsP4 BP, also designated Ras p21 protein activator (GTPase-activating protein) 3 [Ins(1,3,4,5)P4-binding protein], is an 829-amino acid protein that binds phospholipids in both a calcium-dependent and -independent manner. GAP1, one of the Ras GTPase-activating protein families, comprises four distinct genes, including GAP1(m), GAP1-InsP4 BP, MRASAL (murine Ras GTPase-activating-like) and KIAA0538. This family contains an N-terminal tandem C2 domain, a GAP-related domain and a C-terminal pleckstrin homology (PH) domain. The PH domains of GAP1-InsP4 BP are essential for membrane targeting via binding of specific phospholipids. Following agonist-stimulated PtdIns(3,4,5)P(3) production, group I family PH domain containing proteins like GAP1-InsP4 BP specifically bind inositol phosphates, which are subsequently targeted to the plasma membrane.

Specifications

• Accession Number: Q14644
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22821
• Name: Human RASA3 (aa 736-811) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI326412; C86362; E130011G04; GAP1(IP4BP); GAP1-InsP4 BP; GAP1IP4BP; GAPIII; GAPIII activator 3; GTPase activating protein III; GTPase-activating protein 1 family, inositol 1,3,4,5-tetrakisphosphate-binding protein; ins P4-binding protein; Ins(1,3,4,5)P4-binding protein; ras GTPase-activating protein 3; Ras GTPase-activating protein III; RAS p21 protein activator 3; Rasa3; RP11-245B11.3; R-Ras gap; R-Ras GTP activating protein; R-ras GTPase activating protein; R-ras RTPase activating protein-3; scat
• Common Name: RASA3
• Gene Symbol: RASA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining