Invitrogen™ Human RARS2 (aa 44-123) Control Fragment Recombinant Protein

Product Code. 30193919

Brand: Invitrogen™ RP94891

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59020 (PA5-59020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an arginyl-tRNA synthetase that is found in the mitochondrial matrix. Defects in this gene are a cause of pontocerebellar hypoplasia type 6 (PCH6).

Specifications

• Accession Number: Q5T160
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57038
• Name: Human RARS2 (aa 44-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500002I10Rik; arginine--tRNA ligase; Arginyl-tRNA synthetase; arginyl-tRNA synthetase 2, mitochondrial; arginyl-tRNA synthetase 2, mitochondrial (putative); ArgRS; DALRD2; dJ382I10.6; PCH6; PRO1992; probable arginine--tRNA ligase, mitochondrial; probable arginyl-tRNA synthetase, mitochondrial; Rars2; RARSL
• Common Name: RARS2
• Gene Symbol: RARS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining