Invitrogen™ Human RAPSN (aa 226-310) Control Fragment Recombinant Protein

Product Code. 30212425

Brand: Invitrogen™ RP97428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58801 (PA5-58801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q13702
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5913
• Name: Human RAPSN (aa 226-310) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 43 kD receptor-associated protein of the synapse; 43 kda postsynaptic protein; 43 kDa receptor-associated protein of the synapse; 43 kDa; 43 kDa acetylcholine receptor-associated protein; acetylcholine receptor-associated 43 kda protein; AChR associated protein at synapses; acetylcholine receptor associated protein (at synapses; 43 kDa protein; likely to cluster nicotinic AChRs; CMS11; CMS1D; CMS1E; CMS4C; FADS; MGC3597; Nraps; Raps; Rapsn; rapsyn; receptor associated protein of the synapse; receptor-associated protein of the synapse; receptor-associated protein of the synapse, 43 kDa; receptor-associated protein of the synapse, 43 kD; RING finger protein 205; RNF205; twitch once; two)
• Common Name: RAPSN
• Gene Symbol: RAPSN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining