Invitrogen™ Human RAP80 (aa 207-301) Control Fragment Recombinant Protein

Product Code. 30210428

Brand: Invitrogen™ RP96861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57978 (PA5-57978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAP80 was initially identified as zinc-finger containing nuclear protein that is highly expressed in testis and interacts with the retinoid-related testis-associated receptor (RTR). Later experiments revealed that RAP80 is recruited by the Coiled-coil domain 98 (CCDC98) protein to the breast cancer-1 protein BRCA1, allowing the formation of BRCA1 foci in response to DNA damage caused by ionizing radiation. Both RAP80 and CCDC98 are required for DNA damage resistance, G2-M checkpoint control, and DNA repair. Cells depleted of either RAP80 or CCDC98 exhibited increased sensitivity to ionizing radiation, although not as much as in BRCA1-depleted cells, suggesting that RAP80 and CCDC98 control only part of the DNA damage response role of BRCA1. At least four isoforms of RAP80 are known to exist.

Specifications

• Accession Number: Q96RL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51720
• Name: Human RAP80 (aa 207-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430016E08Rik; BRCA1-A complex subunit RAP80; D330018D10Rik; D630032M02Rik; RAP80; Receptor-associated protein 80; retinoid x receptor interacting protein 110; retinoid x receptor-interacting protein 110; RGD1307009; RIP110; Rxrip110; ubiquitin interaction motif containing 1; ubiquitin interaction motif-containing protein 1; Uimc1; X2 HRIP110
• Common Name: RAP80
• Gene Symbol: UIMC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining