missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAP1 (aa 259-392) Control Fragment Recombinant Protein

Product Code. 30196639
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196639

Brand: Invitrogen™ RP89492

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110710 (PA5-110710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human Rap1 was the first identified ortholog of the yeast telomeric protein scRap1, which shares 3 conserved sequence motifs in common. HRap1 is located at telomeres and affects telomere length by being recruited to telomeres by TRF2 instead of directly binding to the telomere like scRap1. The hRap1 cDNA codes for a protein of 399 amino acids with approximate molecular weight of 47 kDa. The hRap1 protein does not interact with TRF1. TRF2 is a ubiquitously expressed protein that is implicated in the control of telomere length(1). TRF2, like TRF1 contains a Myb-related DNA binding motif. It binds to duplex TTAGGG repeats and is localized to all human telomeres in metaphase chromosomes. TRF2 is thought to protect chromosome ends by maintaining the correct structure at telomere termini. The use of mutant forms of TRF2 has implicated a role for TRF2 in the prevention of senescence in primary human cells. Recently, it has been shown that inhibition of TRF2 resulted in apoptosis in a subset of mammalian cell types.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYB0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54386
Name Human RAP1 (aa 259-392) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dopamine receptor interacting protein 5; dopamine receptor-interacting protein 5; DRIP5; hRap1; MNCb-0448; MNCb-0628; PP8000; RAP1; RAP1 homolog; repressor/activator protein 1 homolog; tel; telomeric repeat binding factor 2, interacting protein; telomeric repeat-binding factor 2-interacting protein 1; TERF2 interacting protein; TERF21P; TERF2-interacting telomeric protein 1; TERF2IP; TRF2-interacting telomeric protein 1; TRF2-interacting telomeric protein Rap1; TRF2-interacting telomeric RAP1 protein
Common Name RAP1
Gene Symbol TERF2IP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.